PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn091101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 305aa    MW: 32850.6 Da    PI: 8.6526
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn091101genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-3945102360
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                 +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+
  Achn091101  45 QENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKT 102
                 7889****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2545101IPR003851Zinc finger, Dof-type
PfamPF027018.0E-3346102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.50648102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MIQELLGETS LIGGERKISL SNILEASSSL SPSPSPSPSS SSSAQENLRC PRCDSSNTKF  60
CYYNNYNLTQ PRHFCKTCRR YWTKGGALRN VPIGGGCRKN KTGSAALTPP PSSLGGKTNS  120
SGKFNKAFHC SEVENSGFTQ SPILWAPPQN SHILALLRAN QNPNPNLDMI NPNPVSVKEE  180
SFLSSGTRGL GLDPFYQISP MWRGNLQQGQ QQNGFLLGEV QNTGVQDHYQ RLRSSSAAGY  240
YNNPHDHSLP PVLLSNNIVA SSSSSSTILE SAPVAAAGEL GYWNPMLSWS DHHLPPTANG  300
TAYP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629112e-59KP662911.1 Cajanus cajan Dof7 (Dof7) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079164.15e-86PREDICTED: dof zinc finger protein DOF5.3-like
TrEMBLA0A067KJ606e-86A0A067KJ60_JATCU; Uncharacterized protein
STRINGPOPTR_0007s11620.14e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-36TARGET OF MONOPTEROS 6